PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10428446g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 440aa    MW: 48674.8 Da    PI: 6.0315
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10428446g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-093694012355
                       SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yps++++  LA+++gL+++q+ +WF N+R ++
  MA_10428446g0010 369 PYPSESQKIALAESTGLDQKQINNWFINQRKRH 401
                       8*****************************885 PP

2ELK40.46e-14321342122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK+qLlrKYsgyL+sLkqEF+
  MA_10428446g0010 321 ELKDQLLRKYSGYLSSLKQEFL 342
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-18177221IPR005540KNOX1
PfamPF037901.7E-21178220IPR005540KNOX1
SMARTSM012563.4E-24226277IPR005541KNOX2
PfamPF037914.4E-23229276IPR005541KNOX2
PROSITE profilePS5121311.592321341IPR005539ELK domain
PfamPF037897.2E-11321342IPR005539ELK domain
SMARTSM011887.1E-8321342IPR005539ELK domain
PROSITE profilePS5007112.6341404IPR001356Homeobox domain
SMARTSM003894.4E-13343408IPR001356Homeobox domain
SuperFamilySSF466896.84E-19343417IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-27346406IPR009057Homeodomain-like
CDDcd000862.55E-12353405No hitNo description
PfamPF059201.7E-16361400IPR008422Homeobox KN domain
PROSITE patternPS000270379402IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MMALMTEHQP ESESIMTSIP IPSSYSSYSH GHGHGHGHGH GHGQSECLLS AAAMFQSSRP  60
CQGANKFEPA NAHIGGGGAG HFVMEQFIPE QAVISDSSIS SVKTEVCSGS GGTGVPGQFE  120
LIRRKEEGRC ARAYAEPSFV VTPLVTSLPP QQQEARMVTS LAVDMDSSCS CKPIEADAMK  180
AKIIAHVHYP RLVAAYIDCQ KVGAPPDVVS ELDELSQKCH AQQCVATISI GADPELDQFM  240
EAYCEMFIKY QEELTKPFKE AMAFLKKIEN QLGALTKGTI RTSSLDQGDE RGDGAASSEE  300
EDGSGGEVEF HEVDPHAEDR ELKDQLLRKY SGYLSSLKQE FLKKKKKGKL PKEARQKLLD  360
WWTRNYKWPY PSESQKIALA ESTGLDQKQI NNWFINQRKR HWKPSEEMQF VVMDSPNPHN  420
AAFFLEGHLR TDGTAFSMDC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4832770.0AF483277.1 Picea abies KNOTTED1-like homeodomain protein 2 (HBK2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421735.11e-108PREDICTED: homeobox protein knotted-1-like 1 isoform X2
RefseqXP_010455230.11e-108PREDICTED: homeobox protein knotted-1-like 1 isoform X2
RefseqXP_010438621.11e-108PREDICTED: homeobox protein knotted-1-like 1 isoform X2
SwissprotP466391e-109KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLQ8GZN00.0Q8GZN0_PICAB; KNOTTED1-like homeodomain protein 2 (Fragment)
STRINGAT4G08150.11e-106(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-98KNOTTED-like from Arabidopsis thaliana